SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003677 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003677
Domain Number 1 Region: 379-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-84
Family Protein kinases, catalytic subunit 0.000000000606
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.44e-23
Family PLC-like (P variant) 0.0000399
Further Details:      
 
Domain Number 3 Region: 143-211
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.19e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 248-287
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003677   Gene: ENSMLUG00000004034   Transcript: ENSMLUT00000004037
Sequence length 615
Comment pep:novel scaffold:Myoluc2.0:GL429814:2802074:2866961:1 gene:ENSMLUG00000004034 transcript:ENSMLUT00000004037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFLRIGLSNFDCGSCQPCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFETEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAVNSRETMRAKIKYEVGQPGRTLIRQGS
SDPGKEFVCFLFWGLFWGNSGLRCETCGMNVHHRCQTKVANLCGINQKLMAEALAMIEST
QQARCLRDTEHIYREGPVEIGPPCSIKGEARLPYVLASGKREPQGISWESPLDEMEKICH
HPEPEPNVERPSLHMKLKIEDFILHKMLGKGSFGKVFLAEFKNTNQFFAVKALKKDVVLM
DDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEFLNGGDLMYHIQSCHKFDL
PRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNT
FCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFY
PRWLEREAKDLLVKV
Download sequence
Identical sequences G1P1I5
ENSMLUP00000003677 ENSMLUP00000003677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]