SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003711 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003711
Domain Number 1 Region: 152-437
Classification Level Classification E-value
Superfamily BEACH domain 9.02e-112
Family BEACH domain 0.0000000873
Further Details:      
 
Domain Number 2 Region: 521-717,771-798
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-31
Family WD40-repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 6-132
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000197
Family PreBEACH PH-like domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003711   Gene: ENSMLUG00000004063   Transcript: ENSMLUT00000004074
Sequence length 800
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429973:2134018:2204027:-1 gene:ENSMLUG00000004063 transcript:ENSMLUT00000004074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAWGEQVTQKYSVVLVQGHLVSEALLLFGHQHFYICENFTLSPVGDVYCTRHCLSNISD
PFIFNLCSKDRSSDHYSCRRHSYGDLRLQHLAHIKYQEDIALEIFFRNGCSKFFVFHNSD
RSKVFKSFCSFQPSLKGKGAPEEPLHLRRYPGSDRTMLQRWQKRDISNFEYLMHLNTLAG
RTHNDYMQYPVFPWVLADYTSQTLNLTNPKTFRDLSKPMGAQTKERRLKFIQRFKEVEKT
EGDMTVQCHYCTHYSSAIIPLPRPSARCRSLLSLQGGSFDVADRMFHSVKGAWESASREN
MSDVRELTPEFFFLPEFLTNCNAVEFGCMQDGTALGDVQLPPWADGDPGKFISLHRQALE
SDFVSANLHHWIDLIFGYKQQGSAAVEAVNTFHPYFYGDKVDLGSIGDPLIRNTILGFVS
NFGQVPKQLFTKPHPARTAAGKLSPGKDVTTPSSLQGHPQPFPCSLQALRPSQVTVKDMY
LFSLGSESPKGAIGHIVPTEKSVLAVERGKLLLPPAWSRTFCWGADDLSCCLGSYGSDKV
LMTFENLADWGRCLCAVCPSPTTIVTSGDSTVVCVWELSMAKGRPNGLHLKQALYGHTQA
VTCLAASATFSILVSGSQDCTCILWDLDYLTHVARLPAHQEAISAVAISDISGIVVSCAG
AHLSLWNVNGQPLASITTAWGPEGAITCCCTVEGPAWDASHAIITGSRDGMVRIWKTEDM
KGSVPGQVTPEEPSAPPTSPKGHRCEKNLALCRELDISVALTGKPSKTSPAVTALAMSRN
QPKLLVGDEKGRIFCWSAEG
Download sequence
Identical sequences G1P1L4
ENSMLUP00000003711 ENSMLUP00000003711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]