SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003715 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003715
Domain Number - Region: 136-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00167
Family FCH domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003715   Gene: ENSMLUG00000004077   Transcript: ENSMLUT00000004078
Sequence length 448
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:1119376:1130701:1 gene:ENSMLUG00000004077 transcript:ENSMLUT00000004078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSKTSSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLATAQVKSGETQEEE
GNSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDL
FDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQM
ELKELALEEERLIQELEDVEKNRKLVAEDLEKVQAEAERLDQEEAQYQREYSEFKRQQLE
LDDELKSVENQMRYAQMQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNE
INAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWD
NKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSE
EQWTKALKFMLTNLKWGLAWVSSQFYNK
Download sequence
Identical sequences G1P1L7
ENSMLUP00000003715 XP_006092396.1.53796 XP_006092397.1.53796 XP_014314312.1.53796 XP_014314313.1.53796 XP_014314314.1.53796 ENSMLUP00000003715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]