SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003793 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003793
Domain Number 1 Region: 521-650
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-38
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 183-282
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-17
Family PDZ domain 0.015
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000279
Family SAM (sterile alpha motif) domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003793   Gene: ENSMLUG00000004159   Transcript: ENSMLUT00000004168
Sequence length 1015
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429787:248555:448600:1 gene:ENSMLUG00000004159 transcript:ENSMLUT00000004168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLAGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAVDLLCALNY
GLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSL
LAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHI
ISLSSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHA
GDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLAL
QPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGH
MVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKGRSSSQGRRESTPTYGKLR
PISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKKDTGKKSKK
KSDKSNSPTHYSLLPSLQMDTLRQDIMGTPVPEATLYHTFQQSSLQHKSKKKNKGPLAGK
SKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLYWYINEEDEKAEGFI
SLPEFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLTAGYAERERIK
QEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQS
QSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSA
ALSPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGGKPRSFTLPRDSGFNHCCL
NAPVSACDPQDDVQPTEVEEEEEEEEEGEAAGENIGDKSESRGEKLGDSLQDLYRALEQA
SLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNP
DLTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISTEVDVITSSLTHTHSYIETHV
Download sequence
Identical sequences G1P1S9
ENSMLUP00000003793 ENSMLUP00000003793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]