SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003826 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003826
Domain Number 1 Region: 88-348
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.98e-58
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003826
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0355
Family PHD domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003826   Gene: ENSMLUG00000004198   Transcript: ENSMLUT00000004203
Sequence length 889
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430118:1004474:1053433:-1 gene:ENSMLUG00000004198 transcript:ENSMLUT00000004203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCVGVEEHHAVDIDLYHCPNCAVLHGSSLTKNPVKKRRNWHRHDYTEIDDGSKPVQAGTR
TFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFEVPIMVPKLDDLGLRLPAATFSVM
DVERHVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVE
VPDIARKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKI
FYLIKPTDENLALYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQ
DCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELKED
GFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENS
KPVKSQGIPTVCPASRSSNEATSPYHSRRRMRKLRDHNVRTPSNLDILELHTREVLRRLE
MCPWEEDILSSKLNGKFNKHLQPSSTVPEWRAKDNDLRLLLTNGRIIKYRDERHPFADQS
LYTVDSENEEDKRRTKKAKVKIEESSGIEAVENEESQKPLNRFFTSVKSELRNRSSEYSD
ISDSEDSGPDCTALKNNFTTEESESSGDEKKQKITSNFKEESNVMRNFLQKSQKTSRSEI
PVKRECPTSTSTEEEAIQGMLSMAGLHYSTCLQRQVQSTGCSSERNSLQDPSSCHSIGNG
IKHIGQNIRNVDKLWYHVKTEDQDLRRSSWIKQFDTTSRFNLQPICQDPSRGHKYIKKEG
SSEISQKVHSRNSVDSSGSSPQNGKYMQNSSLVSGACQISNGSVSPERPVGETSFSVPLH
PTKRPASNPPPISNQATKGKRPKKGMATAKQRLGKILKLNRNGHARFFV
Download sequence
Identical sequences G1P1V7
ENSMLUP00000003826 ENSMLUP00000003826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]