SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003844 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003844
Domain Number 1 Region: 218-285
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.36e-18
Family SAM (sterile alpha motif) domain 0.0000939
Further Details:      
 
Domain Number 2 Region: 143-222
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000407
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003844   Gene: ENSMLUG00000004223   Transcript: ENSMLUT00000004223
Sequence length 354
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430899:13427:39216:1 gene:ENSMLUG00000004223 transcript:ENSMLUT00000004223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSSFGSFDRFRNNSVSKPDDSTEVFEGEPINESGEKNKNSNHGGGLGKKMRGISWTMKK
KVGKKYIKALSEEKDEDDGEDALPCRNSDPVIGIHTEKLSLKASDSMDSLYSGWSSSSGI
TSCSDGTSNRDSFRLDDEGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTP
MGMWTGMLNNKVGNFKFIYVDVISEEESAPRKIKTRRRSGREKSKTLQEFLERINLQEYS
STLLLNGYETLEDLKDIKESHLIELNIKNPEDRKRLLSAAENLLDEETIQEQENESVPRS
VSPDISLNKSQLDDCPRDSGCYISSENSDNSKEDLESENLSDMVQKMTIAETSD
Download sequence
Identical sequences G1P1X4
ENSMLUP00000003844 ENSMLUP00000003844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]