SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003857 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003857
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 414-528
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000116
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000259
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 4 Region: 544-736
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000859
Family SPRY domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000003857
Domain Number - Region: 266-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0314
Family Apolipoprotein A-I 0.018
Further Details:      
 
Domain Number - Region: 159-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0806
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003857   Gene: ENSMLUG00000004236   Transcript: ENSMLUT00000004236
Sequence length 760
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:2206156:2215216:-1 gene:ENSMLUG00000004236 transcript:ENSMLUT00000004236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYVGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPERLDRLLKSGFGTYPGRKRGA
LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGSILCQLCKPPPL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEETLR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAVEECQQERLARLGAQLQEHRSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQMSGPAATPPSALPADVGRESPRL
TRLSLPTVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTIEFRRTDVPAQPGPTHWQ
RREEVRGTSALLENPDIGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDGRWGA
SRERLAISKDQRAVRSVPGLPLLLAAERLLTGCHLSVDVVLGDVAVTQGRSYWACAVDPA
SYLVKVGVGLESKLQESFQGAADVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGKI
LLGAGAGAGASAGLTGRDGPAAGCTVPLPPRLGICLDYEQGRVSFLDAVSFRGLLECPLD
CSGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences G1P1Y6
ENSMLUP00000003857 ENSMLUP00000003857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]