SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003875 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003875
Domain Number 1 Region: 528-747
Classification Level Classification E-value
Superfamily Bet v1-like 3.5e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 127-247
Classification Level Classification E-value
Superfamily PH domain-like 9.06e-26
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003875   Gene: ENSMLUG00000004251   Transcript: ENSMLUT00000004254
Sequence length 756
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:38683554:38778933:1 gene:ENSMLUG00000004251 transcript:ENSMLUT00000004254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYSGVPIPPPSSAPPPSPPGVTREGRRLASTGPSPGGGAGRSAGVTAAAAADGWKGRLP
SPLVLLPRSARCQAQRRRRRAGRTSSYLQHPPARERALFPSPSSDISPRGLGAASGAAHG
AGAGLLLACRASMSDNQSWNSSGSEEDPETEFGPPVERCGVLSKWTNYIHGWQDRWVVMK
NNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQW
IDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFR
DILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLF
PQVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRMDKEMEKRRRIE
EGYKNAMIELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLH
WPTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYS
LQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR
NDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIV
CNFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQKISRDNILCKITYVANVNPGGW
APASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences G1P202
XP_006081375.1.53796 ENSMLUP00000003875 ENSMLUP00000003875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]