SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003921 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003921
Domain Number 1 Region: 7-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-61
Family Ankyrin repeat 0.0000532
Further Details:      
 
Domain Number 2 Region: 503-575
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-20
Family SAM (sterile alpha motif) domain 0.0054
Further Details:      
 
Domain Number 3 Region: 440-501
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000353
Family SAM (sterile alpha motif) domain 0.0037
Further Details:      
 
Domain Number 4 Region: 253-330
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000656
Family SH3-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003921   Gene: ENSMLUG00000004298   Transcript: ENSMLUT00000004306
Sequence length 1407
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430099:710752:720981:-1 gene:ENSMLUG00000004298 transcript:ENSMLUT00000004306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLGSTKKINVNFQDPDGFSALHHAALNGNTELITLLLEAQAAVDIKDNKGMRPLHYAAW
QGRKEPMKLVLKAGSAVNIPSDEGHIPLHLAAQHGHYDVSEMLLQHQSNPCMVDSAGKTP
LDLACEFGRVGVVQLLLSSNMCTALLEPRPGDTTDPNGTSPLHLAAKNGHIDIIRLLLQA
GIDINRQTKSGTALHEAALCGKTEVVRLLLDNGINAHVRNTYSQTALDIVHQFTTSQASK
EIKQLLREASAALQVRATQDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDNRTGN
DRVGYFPSSLGEAIVKRAGSRAGAEQSSPQGGSLPGPSAPPEEIWVLRKPFAGGDRSGSL
SSVAVGRSSGAHTLHAGSEGVKLLATVLSQKSISESSPGDSPVKPLEGSAGAARSQPPVA
HAGQVYAELPSKKLEPASEGKSAEAVSQWLATFQLQLYAPNFLSAGYDLPTISRMTPEGL
TAIGVTKPGHRKKITAEISSLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENID
FITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKYEGGPLRQKAPQSLEVMAI
ESPPPPEPAPAECQSPKMTTFQDSELSGELQAAMTGPAEGAATPAAAEKPSNHLPPTSRA
PVRQEPSLGGRARHMSSSQELLGDGFPGPGSPMSRSQEYLLDEGPAPGTLPKEARPGRHG
HSIKRASVPPVPGKPRQVLPPGASPFTPPQTPTKARPGSPQALGVPHGPAPATAKVKPTP
QLLPPMERPMSPRSLPQSPTHRGFAYVLPQPVEGEAGPAAPGPAPASTARPCPCANAVAD
VEPERPTKRAHSLNRYTASDSEQERDELLVPAAAGPYATVQRRVGRSHSVRAPAGADKNV
NRSQSFAVRPRKKGPPPPPPKRSSSAMVSANLADESAPDAETKGAGTEDGQLGVRAQRRR
ASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTPRPDSPEPGRVATVLA
SVKHKEAIGPDGEVVNRRRTLSGPVTGLLAAARRGPGEPAGPADHGHFAEDGTARQRPRG
PAKGEAGGEGPPLARVEASATLKRRIRAKQSQQENVKFILTESDTVKRRPKAKEREAGPE
PPPSLSVYQNGTGTVRRRRGSEHAGPLELPPPPAPTEPLPSDLMHLPPLPPPDSDARKPA
KPPVSPKPVLAQPVPKIQGSPTPASKKVPLPGPSSPALRRERGGFQAKGSEVQSPEAAKQ
TLGPHLEGDRVWEGFGNSDAPGLPGRLPLPAANTPLPGRQPPKSPSAPALHVPAKPPRAA
AVAAAAAAASGPPAAPEGTSLGDSAQQKLEETSACLAAALQAVEEKIRQEDAQGQRPSAS
EKSTGSILDDIGSMFDDLADQLDAMLE
Download sequence
Identical sequences G1P245
ENSMLUP00000003921 ENSMLUP00000003921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]