SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004012 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004012
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000672
Family NTF2-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004012
Domain Number - Region: 90-138
Classification Level Classification E-value
Superfamily Ferritin-like 0.0193
Family Ribonucleotide reductase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004012   Gene: ENSMLUG00000004412   Transcript: ENSMLUT00000004409
Sequence length 340
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429842:3063567:3068617:-1 gene:ENSMLUG00000004412 transcript:ENSMLUT00000004409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLSCPEREGCRKLLGLLDTDEIMALCDTVTNRLVQPEDRQDAIRAILVYSQSVEELLR
RKKVHRDVIFKYLASQGVVIPPATEKHNLIQHAKDHWKKQLHLKLKETPERVNTSQDIRD
FKQLNPQEKEDKTEKVDFRRLGEAFCRWFFELLNSQNPFFGPPQDVWGPQHFWHDVKLRF
YYNTSEQNVTYYHGAEIVSLRLLSLVKEEHLFLSPNLDSHGLKCASSPHGLVMVGVAGTV
HRGNSCLGIFEQIFGLIRCPFGENTWKIKFVNLRIIGQSSLAPEALMKPAITFEPSDLEA
FYNVIVVCGANEVQSNVRQTDSRTGDQGLCSGNEALLNKR
Download sequence
Identical sequences G1P2C6
ENSMLUP00000004012 ENSMLUP00000004012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]