SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004020 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004020
Domain Number 1 Region: 394-630
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.94e-36
Family Ankyrin repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 115-366
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.83e-21
Family Myotubularin-like phosphatases 0.00031
Further Details:      
 
Domain Number 3 Region: 2-107
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000533
Family VPS36 N-terminal domain-like 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004020
Domain Number - Region: 646-692
Classification Level Classification E-value
Superfamily SOCS box-like 0.000798
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004020   Gene: ENSMLUG00000004418   Transcript: ENSMLUT00000004417
Sequence length 695
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:9092168:9182677:-1 gene:ENSMLUG00000004418 transcript:ENSMLUT00000004417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVENVTLLDCYMGKKPANGILYLTETHLIYVEASGAARKETWIALHHIANVEKLTITSLG
CSLILSGKNFQVAHFVLDSDTVCHEVYISLLKLSQPDLPEDLYAFSYTPKSSKEMRENGW
KLIDPISDFRHMGMPSRYGPDMGVWSSTITDANRNYEETCVPMKFSLLIPGSYLTGMGPT
SPKFKSSERFPKCRRISTRNNFACILIALRLSGFNFLSCLNCNCICHSTLYKAPSAEKTF
VCDRKLKLNALTNRAAGKGYENENNYANIRFRFMVIENIHVMQSSLQKLLEDCTTQNPTK
GCVLFGLEDNQSWFIHFHMLCDGKFFLKNALRVEQAHILYHCSSGWRSPLGCLASLGIMP
YCVTFNIITLYWLLMSMTRLSVEITNMNFMDISKIFSLLQPDKEEEDTNTGEKQALREAV
HRNDSYTLDQLLRQECYKRFINSRSGWGVPGTPLRLAAAYGHLNCLQVLLAHGADVDSLD
IKAQTPLFTAVSHGHLDCVRELLEAGACPSGSVYNNCSPILTAARDGAVGILQELLGHGA
DPNVKVKLPVWVSNITSFSGPLFLAAVYGHLDCFRLLLLYGADPNYNCTDQYLLARVPKP
RTLLEICLHHNCDPEYIQLLIDFGANIYLPSVPLDLDRKNDKGTILLLQARATPRTLLSQ
ARIVIRRAFCQANKPQAIDQLDIPPVLISYLKHQL
Download sequence
Identical sequences G1P2D3
ENSMLUP00000004020 ENSMLUP00000004020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]