SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004023 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004023
Domain Number 1 Region: 25-118
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000787
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004023   Gene: ENSMLUG00000004420   Transcript: ENSMLUT00000004420
Sequence length 149
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430109:845294:846888:1 gene:ENSMLUG00000004420 transcript:ENSMLUT00000004420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYNEKELQALSRQPAELAAELGMRGPKKGSVVKRRLVKLVVNFLFYFRTDEAEPVGALL
LEHCRVAQEEPSGFSISFIEDPERKYHFECYSEEQCQEWMGALRRASYEFMRRSLIFYRN
EIQKMTGKDPLEQFGISEEARFQLSGVKA
Download sequence
Identical sequences G1P2D5
ENSMLUP00000004023 ENSMLUP00000004023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]