SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004060 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004060
Domain Number 1 Region: 525-668
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 2 Region: 675-801
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-20
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 
Domain Number 3 Region: 1089-1220
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-18
Family Second domain of FERM 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004060
Domain Number - Region: 15-128,575-595
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000115
Family BAR domain 0.066
Further Details:      
 
Domain Number - Region: 1222-1282
Classification Level Classification E-value
Superfamily PH domain-like 0.00422
Family Third domain of FERM 0.061
Further Details:      
 
Domain Number - Region: 989-1066
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00424
Family Ubiquitin-related 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004060   Gene: ENSMLUG00000004455   Transcript: ENSMLUT00000004461
Sequence length 1359
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429852:2059955:2104003:1 gene:ENSMLUG00000004455 transcript:ENSMLUT00000004461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPKVETQTSMDWQKRYLALETQLVRFRLQASKIRELLSDKMQELEQRLQEAEQRAENS
ETQVSVMEEKVKLSNLKNVGSAGSLHRKYQELLKAVQGKDERIGQLEAQLEKQKQMRAEE
AKIVQEKAAKIKEWVTLKLAELEMENQHLKSCNQRLVEQVAALQEALEALQMALSENLLV
APQEIPEQDSVPAGPGAQLMGQDSGAQAQDPLKAALPSEDSVPEVRSATEEFGSIVVRPG
GLSEAKTLPSRLGREGSPGQLCMQTCTPGHALSSWDEGLATAQAGSLPGTKTSAREGGPG
CSLTLPKVRDPSAPYDSVQLAKRHHSQPPVGPERSNHVGSAEIGTLAALPHSGLPKVAAP
AELEEEPEKMEMEEPPPAVRKEERESQKVSTAELEEVDSGGKPPTPPLHRFPSWESRIYA
VATSGMCLSDVPPRSSATCFGSRPPSISSPGPFSGLVYKNCTVPVYTVLKGRVTQISTVP
FVDESSGSDDDCSSQASFQSSVPCSEPRKTSGLGSPRAIKRGQVSPMSSLSSEGDYAPPD
ACSLDSDYSEPHKLQRTSSYSTEGTNPGRSEESLEKSGYLLKMGSRVKTWKRRWFVLRQG
QILYYKSPSDIIRKPQGQVELNSRCQIVREEGAQTFQLISEKKTYYLTADSPCLLEEWIR
VLQRLLKVQALGPPALPQGGTKPTVKGWLTKVKHGHSKLVWCALVGRTFYYYRSHEDKRP
LGHLPVQDAHVEEVDRSCDSDEDYEAGGTGRLLSSHCTLVIQPPEHSPTYLLIGTKHEKD
TWLYHLTVATGGSSAKVGTAYEQLIGKLMDAEGDPDSPLWRHPMLCYSKDGLYTSLTTLP
SEALQTEALKLFKCCQLFINVPVEAASVDYHVSLVQRALQVCLVHPELQSEIYCQLMKQT
SCRPPQKYSLTQCWQLLALCAPLFLPQHHFLWYIKQQLQRHADPRNETGQYATYCQRAVE
RTLQTGEREARPSRTEVMSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQR
LNQETGMRNPSHSGFALFTDDPSGRAVEHCLQGRVKLCDAISKWEQALKELHSRKSKGGT
RDVRLMYKSRLYFRGQVKGETERERLLLAFQTSGEIVAGRFPVNKELALEMAALMAQVEF
GDLERHLSPSPGGTPPSKAQHHLQQVLDRFYPRRYRYGTPTEQLRHLVDQLTTKWAALQG
CSPPECIRIYLTVARKWPFFGAKLFAAQPVPLSSKENPLVWIAVNEDGVSILDHNTMQVR
VTYPYSSVTTFGGCRDDFMLVIRSIPDQSSGKGHIEKLTFRMAAPKIAEATLLMASYMSH
CSITVNTPTKPPAAHQPWELAGQQLFASLPRAAKGPTLL
Download sequence
Identical sequences G1P2H1
ENSMLUP00000004060 ENSMLUP00000004060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]