SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004061 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004061
Domain Number 1 Region: 432-769
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.05e-56
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 2 Region: 5-92,157-184
Classification Level Classification E-value
Superfamily EF-hand 2.55e-37
Family EF-hand modules in multidomain proteins 0.012
Further Details:      
 
Domain Number 3 Region: 246-323
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 
Domain Number 4 Region: 163-248
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000953
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 5 Region: 328-386
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000082
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004061   Gene: ENSMLUG00000004459   Transcript: ENSMLUT00000004462
Sequence length 792
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:8894303:9048078:1 gene:ENSMLUG00000004459 transcript:ENSMLUT00000004462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSEERWVSLTSEEFDQLQKYSEYSSKKIKDVLAEFNESGSLKQFDSHETISYDVFKLFM
RAYLEVDLPQPLSTHLFLAFSQKPRQEVPDHPKEGTRNSEASAPDSNIQNVDNAAKADEA
CAPDMESEITEKQVPAKDQGAATSLGNPVAQSSGSEPPTVYLKDVVCYLSLLETGRPQDK
LEFMFRLYDSDENGLLDQAEMDRIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGF
VSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHVMLMGVRKQG
LCCTYCKYTVHERCVSKNIPGCVKTYSRTKRGSEVMQHAWVEGNSSVKCDRCHKSIKCYQ
SVTAWHCVWCRKTFHRKCELSTVCDGGELKDHILLPTSICPITQDRQGGKSDGDASAKGE
LVTQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFF
RDTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGS
LTKILKEIEQSPLVMLDRWHLEVIPREEMENGDQVPYDIMNNYFSIGVDASIAHRFHVMR
EKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILN
IPSMYGGTNLWGETKKNRAVIQECRKVVTDPKELKFCIQDLSDQLLEVVGLEGAMEMGQI
YTGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPPCTIKIIHKNQAPMMMGPPQKSS
FFSLRRKSRSKD
Download sequence
Identical sequences G1P2H2
ENSMLUP00000004061 ENSMLUP00000004061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]