SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004074 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004074
Domain Number 1 Region: 72-199
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-45
Family Regulator of G-protein signaling, RGS 0.00000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004074   Gene: ENSMLUG00000004478   Transcript: ENSMLUT00000004477
Sequence length 211
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430235:165433:167980:1 gene:ENSMLUG00000004478 transcript:ENSMLUT00000004477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAMFLAVHHDCGSMDKSSGSSPKSEEKREKMKRTLLKDWKARLSYFLQHSSSPEKPKT
GKKSKQQTCIRPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKAKKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFATAQKRVYSL
MENNSYPRFLESAFYQDLCKKPQITAEAHAT
Download sequence
Identical sequences G1P2I4 S7NJZ7
ENSMLUP00000004074 ENSMLUP00000004074 XP_005882493.1.60319 XP_006103256.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]