SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004077 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004077
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-40
Family Regulator of G-protein signaling, RGS 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004077   Gene: ENSMLUG00000004482   Transcript: ENSMLUT00000004480
Sequence length 124
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430235:122614:124049:1 gene:ENSMLUG00000004482 transcript:ENSMLUT00000004480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMSPLLLDGPVVYAAYLKLEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQS
PREINIDSSTRETIIRNIQEPTPTCFEEAQKIVYTHMERDSYPRFLKSEMYQKLLKTIQP
NDNS
Download sequence
Identical sequences G1P2I7
ENSMLUP00000004077 ENSMLUP00000004077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]