SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004081 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004081
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-48
Family Regulator of G-protein signaling, RGS 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004081   Gene: ENSMLUG00000004484   Transcript: ENSMLUT00000004484
Sequence length 209
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430235:73775:77169:1 gene:ENSMLUG00000004484 transcript:ENSMLUT00000004484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAAMPAPRLHKMPGMLFSAPPKELQGTDHSLLDDKTQKRRPKTFGMDVKAYLRSMIPH
LESGMKPSRSKDILSADEVLQWSQSLEKLLANRAGQDVFGSFLKSEFSEENIEFWLACED
YKRTESDLLHGKAEKIYKSFVHSDAAKQINIDFHTRESTAKKIKAPTPTCFDEAQKIVYT
LMEKDSYPRFLKSNIYLNLLNDLQANSLK
Download sequence
Identical sequences G1P2J1
ENSMLUP00000004081 ENSMLUP00000004081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]