SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004089 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004089
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-19
Family PDZ domain 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004089
Domain Number - Region: 129-172
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0157
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004089   Gene: ENSMLUG00000004492   Transcript: ENSMLUT00000004494
Sequence length 197
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429927:771330:777410:1 gene:ENSMLUG00000004492 transcript:ENSMLUT00000004494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AELYRALAVSGGTLPRRRCGSGFRWKNLNQSPEQQRKVLTLKKEENQTFGFEIQTYGLHH
REEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLR
LETLYGTSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHAGLVVKDPSIYDPLEV
RSGLYGAGRLHGSLPFG
Download sequence
Identical sequences G1P2J8
ENSMLUP00000004089 ENSMLUP00000004089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]