SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004117 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004117
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 3.27e-61
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 190-358
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.1e-26
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004117   Gene: ENSMLUG00000004525   Transcript: ENSMLUT00000004526
Sequence length 415
Comment pep:novel scaffold:Myoluc2.0:GL429787:2818680:2884059:1 gene:ENSMLUG00000004525 transcript:ENSMLUT00000004526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFRCLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENRSPEDPKVLDNFLQVLIQVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYMVAPELEIEEFNAKAPGKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEAYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPSRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSREPRDASKYKAKQDKIKTNRTF
Download sequence
Identical sequences G1P2M3
ENSMLUP00000004117 ENSMLUP00000004117 XP_006085702.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]