SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004165 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004165
Domain Number 1 Region: 69-369
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-84
Family Protein kinases, catalytic subunit 0.000000000137
Further Details:      
 
Domain Number 2 Region: 337-357,432-552
Classification Level Classification E-value
Superfamily PH domain-like 4.44e-46
Family Pleckstrin-homology domain (PH domain) 0.000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004165   Gene: ENSMLUG00000004579   Transcript: ENSMLUT00000004578
Sequence length 557
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430099:1043288:1105254:-1 gene:ENSMLUG00000004579 transcript:ENSMLUT00000004578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISFSWVHQYDTIPIQSSVVLCSCPSPSMVRTQTDSGSAPVPSGGSRQGPTMDSTAAESRP
SANSLQRAAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHII
KENKVPYVTREKDVMSCLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDE
TCTRFYTAEMVSALEYLHGRGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARA
NSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEY
DFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHSFFESITWENLHHQTPPKLT
AYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRAGSNIEQYIHDL
DTNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLT
EGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKI
QEVWRHRYQSHPDTTVQ
Download sequence
Identical sequences G1P2R5
ENSMLUP00000004165 ENSMLUP00000004165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]