SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004167 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004167
Domain Number 1 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 2 Region: 449-574
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-27
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 3 Region: 879-1032
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-20
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-17
Family SAM (sterile alpha motif) domain 0.0000501
Further Details:      
 
Domain Number 5 Region: 581-702
Classification Level Classification E-value
Superfamily PH domain-like 7.8e-16
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 6 Region: 1112-1215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000667
Family BCR-homology GTPase activation domain (BH-domain) 0.0047
Further Details:      
 
Domain Number 7 Region: 1016-1127
Classification Level Classification E-value
Superfamily PH domain-like 0.000000011
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004167   Gene: ENSMLUG00000004561   Transcript: ENSMLUT00000004580
Sequence length 1216
Comment pep:novel scaffold:Myoluc2.0:GL429815:7337538:7431229:1 gene:ENSMLUG00000004561 transcript:ENSMLUT00000004580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEVNVDIKDFLMSINLEQYVSHFREFGFHTVKDCAAIDDSVLHKIGISPTGHRRRI
IKQLQIILSKMQDIPIYANIHKIKKNDETSKGHPAPSSGQDTCIELSDSSGVQTPSPAHL
ETVTKHLDQSDIGVENSQCLKSDDELSLPKHSFPIHEEGHHLKFGSFQDSLLGSENIQIE
SLIAKETVDCTTKEQQTEKVDLNSEDVNKLPNVDPDRLPSLGCSVSEANSGHGTNGLLER
SPPSPLFNFQGQMVINDLYVPSSPFLTPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGI
SGSYFRERRNGATSTGKSVTQHNSNEENSSSIFPYGETFLFQRLETSKKKSIRNEFWAHE
ETLKGKATTERNSFFVQSSIYDNRKENVSEDKVEDIWIPREDKNNFPTGGAADSEYSTVE
ECFQSLKRKNSKASKSRTQKVLNLDPVNRHSYPLSSTSGNADSSVISSSPISPYACFYGS
SAKKVKSGWLDKLSPQGKRMFQKRWVKFDGFSISYYNNEKEKYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWVSILLNALKSQSPSSQSQAAAAPEKCGYLELRGY
KAKIFTVLSGNSVWLCKNEQDFKGGFGITIIPMNVANVKQVDRTMKQSFEIITPYKSFSF
VAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHM
DAPVEKRKSFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKSDVLETMALLFSGADVM
CATGDPVHSTPYQLAKKAGQSLQMEFLYHNKFSDFPQHDVHFEGGLSQESAQCTFLCDFL
YQAPSAASKLPAEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTINISDVICLAVHKE
DFYINTGPIFTFEIYLPSERAFLFGAETFQAQRRWTEAIAKQFVPFFAENLTQANYDLIG
QLYYKDCHALDQWKKGWFAMDKSSLCFCLQTQEVQEDRMNLRRLQELTISTMVQNGEKVD
ILLLVEKGRTLYIHGHTKLDFTVWHAAIEKAAGTDGNALQDQQLSQNDVPIIVNSCIAFV
TQYDKGLGCKYIYQNSGDPLHVSELLESFKKDARSFKLRAGKHQLQDVTGVLKRFLSDID
DALLTKELYPYWISAL
Download sequence
Identical sequences G1P2R7
ENSMLUP00000004167 ENSMLUP00000004167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]