SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004178 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004178
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.57e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 260-325
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000218
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 624-738
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000148
Family Ankyrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 848-897
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000453
Family MYND zinc finger 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004178   Gene: ENSMLUG00000004589   Transcript: ENSMLUT00000004593
Sequence length 916
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:736620:768759:-1 gene:ENSMLUG00000004589 transcript:ENSMLUT00000004593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGYGEFSWPTGESYHGQFYRDHRHGFGTYMWPDGSSFTGMFYLSFREGYGTMYMKTRL
FQGLYKADERFGPGIETYPDGSQEVGLWFREHLIKLCTEIPCSVSISSYPEFQGFLTHSP
ARISLSEEETMHWDLQEERDPFFYNYKQFLLNDDLTLPPDVYLYSTDNTHMPITRSFRRD
LDSRIFLHDIPPFVEDGEPWFIKNETPLMVKIQKHTYKFRNKKEHSSWNMGAILEGDRSG
FACRGPKERLAKEMILKAEEGNYDWIYGILRDNLASPDVADARGYTVLAAAAIHCHINII
NLLLDNGADVNKCTDEGLTPLNMCFLLYYPATSFRPNIAERTVPEPQEKAFTQPILCPPQ
TEFFSVSSVFLGQKLFTTITTDFQGLESRQTPRPPNLKYLQKKWESTLPRGSVSISDQGQ
ELEDVLESLDRCTPCSSTETNFESNHCVQNYSIRLSWNMLEKSARAYSMLKVPSPEAISD
KGTMRQMAWTMTKVSHRVSITFLLPWEGMFSSACALSLRVLDWHMGSGHHTGVHTLSPPY
TQHGCTLPPSSQSRTHVHLGTISVRQSVYMTKSRHHRSTRRIPLGGSGAASVYMWCGVQP
EMLPSSMKLNNEVGPPRVYSSVNMSVPEEGGRTPLHVACEREDNYRYARDVVHLLLSNRA
NSSLLWGGHSPLSLSIASGNDLIVKELLTNGADPNLPLTKGLGNALCVACDIAYEHRRSV
NSRLGLIDLLINYGADILAPVTLTQGDKVAVGTAVDYGYFKFFQDRKIAHCPFHTLMPAE
RETFVARKRLLEYMGFQLRSAIMAKESLWDPKVLCLSKKAQMIPCHKLKQRDPSTPKDPQ
LEELEQTPFFKFCYQCGRSIGVRLLPCSRCYGILTCSKSCKTKAWADFHGRDCGTLAAIG
PHGSCRGPVWRIHWTP
Download sequence
Identical sequences G1P2S7
ENSMLUP00000004178 ENSMLUP00000004178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]