SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004194 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004194
Domain Number 1 Region: 57-137
Classification Level Classification E-value
Superfamily HMG-box 6.68e-24
Family HMG-box 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004194   Gene: ENSMLUG00000004609   Transcript: ENSMLUT00000004609
Sequence length 411
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430096:1223245:1239189:-1 gene:ENSMLUG00000004609 transcript:ENSMLUT00000004609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTERPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE
AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD
DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKIEVDMEKIAAEIAQAEEQARKRQ
EEREKEAAEQAERSQSSIVPEEEQATNKTEEKKEAENIPMETEETRLEETTESQQNGEEG
TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE
Download sequence
Identical sequences G1P2U2
ENSMLUP00000004194 ENSMLUP00000004194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]