SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004195 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004195
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-72
Family FCH domain 0.0028
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004195   Gene: ENSMLUG00000004611   Transcript: ENSMLUT00000004610
Sequence length 486
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430553:151346:173678:1 gene:ENSMLUG00000004611 transcript:ENSMLUT00000004610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAVMSEAEKVSELHLEVKASLMNEDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAYHAACKEEKLAISRESNSKVDP
SLNPEQLKKLQDKVEKCKQDVLKTKEKYEKSLKELDQSTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVSSYKNIYRELEQSLKAADAVEDLRWFRANHGPGMSMNWPQ
FEEWSADMNRTLSRREKKKPADGVTLTGINQTGDQALQNKPSSDLSVPSVPTRSAQSLSS
YNPFEDEDDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
EDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
Download sequence
Identical sequences G1P2U3 S7MJB3
ENSMLUP00000004195 ENSMLUP00000004195 XP_006106288.1.53796 XP_014390599.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]