SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004210 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004210
Domain Number 1 Region: 508-569
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000163
Family SH3-domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004210
Domain Number - Region: 86-167
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0327
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004210   Gene: ENSMLUG00000004622   Transcript: ENSMLUT00000004625
Sequence length 575
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429852:628493:761694:1 gene:ENSMLUG00000004622 transcript:ENSMLUT00000004625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGPASGRIRALEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE
NGAKELWFFLQSELKKLKNLEGNELQRHVDEFLSDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRYGISTGHWSGEIKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPSYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYPHQPRTADEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
Download sequence
Identical sequences G1P2V6
ENSMLUP00000004210 ENSMLUP00000004210 XP_005877963.1.60319 XP_005877964.1.60319 XP_006091039.1.53796 XP_006091040.1.53796 XP_014313270.1.53796 XP_014313271.1.53796 XP_014313272.1.53796 XP_014313273.1.53796 XP_014313274.1.53796 XP_014313275.1.53796 XP_014313276.1.53796 XP_014404633.1.60319 XP_014404634.1.60319 XP_014404635.1.60319 XP_014404636.1.60319 XP_014404637.1.60319 XP_014404638.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]