SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004285 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004285
Domain Number 1 Region: 84-201
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.45e-31
Family YigZ N-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004285   Gene: ENSMLUG00000004709   Transcript: ENSMLUT00000004709
Sequence length 228
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431414:31443:43118:-1 gene:ENSMLUG00000004709 transcript:ENSMLUT00000004709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFRQNIGESILYLWVEKIRDVLIQKSQMTEPGPEVKKTTEEEDVESEDDGLVACQPETPG
RALGLDVGESQTGTGADELPPIDHGVPITDRRSFQAHLAPVVCPKQVKMVLAKLYENKKI
ASATHNIYAYRIFCEDKQTFLQDYDDDGETAAGGRLLHLMEVLNVRNVLVVVSRWYGGIL
LGPDRFKHINNCARSILVERSYAGSPEESSKALGKNKKVRKDKKRSEH
Download sequence
Identical sequences G1P312
ENSMLUP00000004285 ENSMLUP00000004285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]