SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004348 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004348
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.4e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004348   Gene: ENSMLUG00000004780   Transcript: ENSMLUT00000004776
Sequence length 152
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429854:4330277:4336093:1 gene:ENSMLUG00000004780 transcript:ENSMLUT00000004776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYTGSQYIGEFVDGRMEGEAEYILPTETRYVGYMKDGMFHGQGTLYFPNGSRYDAIWEK
GFAVQGTYTFSDGLQYDAKNWHYCDGYDRRFYTEICHGLKPTGISQLSNMDPPRKIPAGY
YDCGDGFYNPKTRVVRDYMKQFLRNAGMFILT
Download sequence
Identical sequences G1P369
ENSMLUP00000004348 ENSMLUP00000004348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]