SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004377 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004377
Domain Number 1 Region: 108-207
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.000026
Further Details:      
 
Domain Number 2 Region: 195-293
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-16
Family PDZ domain 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004377   Gene: ENSMLUG00000004807   Transcript: ENSMLUT00000004806
Sequence length 298
Comment pep:novel scaffold:Myoluc2.0:GL429784:12416486:12429838:1 gene:ENSMLUG00000004807 transcript:ENSMLUT00000004806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYPSLEDLKVDKVIQAQSAFSANPANPAILSEASAPISQDGNLYPKLYPELSHYMGLS
LNGEEIEANMAMVSGAPTQGQLVARPSSMNYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICE
INGQNVIGLKDSQVADILSTSGTVVTITIMPAFIFEHIIKRMAPSIIKSLMDHTIPEV
Download sequence
Identical sequences L7N173
ENSMLUP00000004377 XP_006085362.1.53796 XP_014308202.1.53796 ENSMLUP00000004377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]