SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004394 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004394
Domain Number 1 Region: 17-283
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.98e-40
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 828-885
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-22
Family Tudor domain 0.00038
Further Details:      
 
Domain Number 3 Region: 886-941
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000102
Family Tudor domain 0.00022
Further Details:      
 
Domain Number 4 Region: 662-698
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000709
Family PHD domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004394
Domain Number - Region: 757-794
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00775
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004394   Gene: ENSMLUG00000004815   Transcript: ENSMLUT00000004823
Sequence length 1006
Comment pep:novel scaffold:Myoluc2.0:GL430072:71084:352304:1 gene:ENSMLUG00000004815 transcript:ENSMLUT00000004823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKY
CTPRYLDYEDLERKYWKNLTFVAPIYGADINGSIYDEGVAEWNIARLNTILDVVEEECGI
SIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGF
FPSSFQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCA
ESTNFATVRWIDYGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQLWKQGKDIYTIDHTKP
TPETTPEVKAWLQRRRKIRASRSFQCTSSHSKRPKNEEDEEVSAAVDGAQGPTPDPDPDP
DDLKVSEQPEAAVKLENIEAPSEGVASARRMQLDQNLLDNIGLSGNSCLSTSVKEEIKTK
DDQAYAIIPSSNTRETADSISIGHLTPKESDPPKHPWPKLPELCSSVPESNSWLTEGEGS
NVESRVSGLEPGEVPAVPSGERNGFRVPSRIEGETKTAKSWRHPLSKPPARSPMTLVKQQ
ATSDEELPEVPLIEEEVEETESWAKPLVHLWQTKAPNFVAEQEYNAAMGRMEPHCAICAL
LMPYYKPESSNEENDSRWETKLDDMVASGGKTKPLIPEMCFIYSEENIEYSPPNAFLEED
GTSLLISCAKCCVRVHASCYGIPSHEISDGWLCVRCKRNAWTAECCLCNLRGGALKETKD
NKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRYRVKKVSGACIQCSYG
RCPVSFHVTCAHAAGVLMEPDDWPYVVNITCFRHKANPNMKLKAGERGISVGQTVITKHR
NTRYYSCRVIAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCVKLGPPAEGEVVEVKWPDG
KLYGAKYLGLNVAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTF
YGADIIQGEKKRQRVLSSRFKNEYVDDPVYRTFLRSSFQKKCQKRQ
Download sequence
Identical sequences G1P3A9
ENSMLUP00000004394 ENSMLUP00000004394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]