SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004401 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004401
Domain Number 1 Region: 282-574
Classification Level Classification E-value
Superfamily BEACH domain 1.16e-117
Family BEACH domain 0.0000000525
Further Details:      
 
Domain Number 2 Region: 618-917
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.95e-58
Family WD40-repeat 0.00072
Further Details:      
 
Domain Number 3 Region: 191-284
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-16
Family PreBEACH PH-like domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004401   Gene: ENSMLUG00000004814   Transcript: ENSMLUT00000004831
Sequence length 919
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429784:12432146:12463252:-1 gene:ENSMLUG00000004814 transcript:ENSMLUT00000004831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLYLKKKINMRYLPAPQSRFSLLLLNLEEYFFEQHTAHHIQHKGSQKERRVRGSLKICSK
SVIFEPDAISQPIIKIPLRDCIKIGKHGENGTNRHFAKAKSGGISLIFSQVYFIKEHNIV
APYKIERGRMEYVFELDVSGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTS
FDKNRFQSVSEKLHMECKAEMVTPLVTNPGHVCITDTTLYFQPLNGYPKPVVQITLQDVC
RIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYDPQDRDELYFYIATYLEHHVAERTAESY
TLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIISDYCSSELDLSNPGTFRDLGK
PVGALNKERLERLLERYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDNA
DRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLDLGKRQGGQMVDDVELPP
WARSPEDFLQKSKEALESNYVSKHLHEWIDLVFGYKQKGSEAVGAHNVFHPLTYEGGVDL
NSIEDPDQKVAMLTQILEFGQTPKQLFVTPHPQRITENFKSLPQTSCDNISIADSPVSPG
EESFEDLTEESKKLAWNNIAKLQLHEQHKLHKEAVTGIAVSCNGSSVFTTSQDNTLKMFS
TESKMLQRSISFSDMALSSCLLLPGDATVISSSWDNNVYFYSIAFGRSQGTLMGHDDAVS
KICWHDNRLYSASWDSTVKVWSSVPAEMTGTKRHQFDLLAELEHDVSVDTISLNAASTLL
VSGTREGKVTIWDLTTATILHQIPCHSGTVCDTAFSPDSRHVLSTGEDSCVNVIDVQTGM
LISSMTSDKPQRCFIWDGNTVLSGSQSGELLVWDLLGGKLCERIQGHKGAVTCIWMNEQC
SSIITGGEDKKIMFWKLQY
Download sequence
Identical sequences G1P3B6
ENSMLUP00000004401 ENSMLUP00000004401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]