SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004429 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004429
Domain Number 1 Region: 1954-2060
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-30
Family PDZ domain 0.0000678
Further Details:      
 
Domain Number 2 Region: 1592-1706
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-26
Family PDZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 351-469
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-26
Family PDZ domain 0.002
Further Details:      
 
Domain Number 4 Region: 1844-1943
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-25
Family PDZ domain 0.0058
Further Details:      
 
Domain Number 5 Region: 235-340
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-25
Family PDZ domain 0.012
Further Details:      
 
Domain Number 6 Region: 1134-1234
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-25
Family PDZ domain 0.0000161
Further Details:      
 
Domain Number 7 Region: 1714-1798
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-24
Family PDZ domain 0.0052
Further Details:      
 
Domain Number 8 Region: 131-232
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.0047
Further Details:      
 
Domain Number 9 Region: 686-782
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-23
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 10 Region: 1329-1426
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-22
Family PDZ domain 0.037
Further Details:      
 
Domain Number 11 Region: 6-64
Classification Level Classification E-value
Superfamily L27 domain 6.28e-20
Family L27 domain 0.00066
Further Details:      
 
Domain Number 12 Region: 1459-1555
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 13 Region: 544-633
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-18
Family PDZ domain 0.04
Further Details:      
 
Domain Number 14 Region: 984-1082
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-18
Family PDZ domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004429   Gene: ENSMLUG00000004842   Transcript: ENSMLUT00000004862
Sequence length 2061
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429846:1604927:1736866:1 gene:ENSMLUG00000004842 transcript:ENSMLUT00000004862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFGVDKNRALQAAERLQAKLRERGDVANEDKLNLLKSVLQSPLFSQILNLQTSVQQLK
DQVNIATSAISNVECAHIPHLSPAVITTLQNESLLSSQNNGTLEVLTAAGVPHINGKTAC
DEFDQLIKNMAQGRHVEVFELLKPPCGGLGFSVVGLRSDNRGELGIFVQEIQEGSVAHRD
GRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLIIARGSLPPLISPVVSRSPSA
ASTISAHSNPVHWQHVETIELVNDGSGLGFGIVGGKATGVIVKTILPGGVADQHGRLCSG
DHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGALEEPAAPTSLGITVSSSPSSTP
EMRVDASTQKSEDNETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHD
GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVHLTLMRRGTKQEAELTAREDVTKD
VVLSPANENYEKDEDSLCLRRNTSILPIEEEGYPLLLAEIEEMEDAQQREAALLKKWQRI
MGINYEIVVAHVSKFSESSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNG
ITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDGLDLCDIELTEKPHVDLGEF
IGSSETEEPALEMPDVGRDPGKVHGPLAMWEVDVQHIELEKGSKGLGFSILDYQDPVDPA
STVIVIRSLVPGGVAEKDGRLLPGDRLMFVNDVNLESSSLEEAVQALKGAPSGTVKIGVA
KPLPLSPEEGYVSAKEDSFLYPPHSCQEEGLADKALFRADLALVDTNDADFADESAFESH
YSPDDSIYSTPASILSLHSSACSDGLNYGPSLPPSPPKDVTDSSSDPILDLQVPLEELYT
QNLLQRQDDSPPSVDLSMGPASGFIVNDYTPEQQYGCENTGMWAESHLPSEVISSAELTS
LLPDSTGKGSEFLNQQSSLASTAERIMLQNISRELFEKTITIAKGNSSLGMTVSANKDGL
GVIVRSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYV
PAEHLEEFRRSLGQQSGGIMALDIFSPYTGRDIPELPEREEGEGEESELQNAAYSNWNQP
RRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIV
EVDGLDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLTHSLYPQYNFSSTNP
FADSLQFIADKAPSQSEPEPEKAPLCNAPLPPPSAFAEMSGDHAQSSASRDSEEGDKEDE
FGYSWKNIRERYGTLAGELHMIELEKGRSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKD
GRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVSQMAVCPGNTVES
LPSTSENLQNKEAEPSFATSDAAVDFSSFTNVQHLELPKDQGGLGIAISEEDTLRGVIIK
SLTEHGVAAKDGRLKVGDQILAIDDEVVVGYPVEKFISLLKTAKTTVKLTFRAENPDSQA
VASAAGTSNGEKKNSSQAPMVPPPGSPEPEPVRSTSRSSTPAVFASDPTTCPIIPGCETT
IEISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKAT
HDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTLTIELQKKPGKGLGLSIVGKRNDTGV
FVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG
PFHSERRPSQSSQMSECSLSSFTFPLSGSSASESLESSSKKNALASEIQGLRTVEIKKGP
TDSLGISIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTIGGTSTEGMTHTQA
VNLLKSASGSIEMQVVAGGDVSVVTGHQQEPASSSLPLTGLTSSSIFQDDLGPPQCKSIT
LDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVT
HEEAVAILKRTKGTVTLTVLS
Download sequence
Identical sequences G1P3E1
ENSMLUP00000004429 ENSMLUP00000004429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]