SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004431 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004431
Domain Number 1 Region: 622-783
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.23e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0016
Further Details:      
 
Domain Number 2 Region: 761-878
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.94e-25
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 48-149
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-19
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004431   Gene: ENSMLUG00000004864   Transcript: ENSMLUT00000004864
Sequence length 934
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429947:1586948:1627421:1 gene:ENSMLUG00000004864 transcript:ENSMLUT00000004864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAREKPPEPSSPALGSREPAGLAGGPEVLPPEESEGCARPPETAPKKLCGYLSKFGGK
GPIRGWKSRWFFYDERKCHLYYSRTAQDANPLDSIDLASAVFDCKADAEEGTFEIKTPGR
IITLKAANKQVMLYWLQQLQMKRWEFHNSLPAPPVVPDAALAGNEPALRLELEQEEAELE
EFLHPVKTPPGLVGMAAALQPAPAMPLALQNISLKHLGTEIQNTMYNIRGNRQAQGTGHG
PPGEDPLPSSEPQRAERPSSPDPSAPGKDPGETLKPAPKSSLTANLIQKAKRQNNTFPLF
AEGLTRNRTAQERALALEQQVLMLTKELKSQKELVRILHKALEAAQQEKRATCAYLAAAE
DKDRLELVRHKVRQIAELGRRVEALEQERESLAQTASLHEQQVQELQQHVQLLMDKNQAK
QQVICKLSEKVTQDFIHPPNPLLVPPDAANRDFLSQQEKMEHLKDDMEAYQTQNRFLNSE
IHQVTKIWRKVAEKERTLLMKCAYLQAKNCQVESKYLAGLRRLQEAMGNQGSECAELLRQ
LIQEALQWEASEASADSVELSPISEYDEYGFQTVPNYEVEDLKLLAKIQALEVRSHHLLA
HEAMERPLRERWAALGELAPSVELKQLLRMGVSREHRPRVWRWLVHRRVQHLQAPGRYQE
LLSRSQTCKHPAARQIELDLNRTFTNNKHFTCPTSSFPDKLRRVLLAFSWQNPSIGYCQG
LNRLAAIALLVLGEEESAFWCLVAIVETIMPADYYSKTLTASQVDQRVLQDLLSEKLPRL
MAHLGQLRVDLSFITFNWFLVVFADSLISNILFQVWDAFLYEGTKVVFRYALAIFKYTEE
EILRLQDSLEIYQYLRFFTKTIFNSRKLMSIAFNDMNPFPMKQLQQLRAVHRERLEAELR
ELEQFKAEYLETRAAQDPVVPEGCTSEDEGDGEA
Download sequence
Identical sequences G1P3E3
XP_006096541.1.53796 ENSMLUP00000004431 ENSMLUP00000004431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]