SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004439 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004439
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-22
Family PDZ domain 0.0000887
Further Details:      
 
Domain Number 2 Region: 168-271
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 422-516
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-17
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 4 Region: 695-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000835
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 5 Region: 517-577
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000984
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004439   Gene: ENSMLUG00000004865   Transcript: ENSMLUT00000004873
Sequence length 1757
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430514:102653:140936:-1 gene:ENSMLUG00000004865 transcript:ENSMLUT00000004873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRERPLSKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
PEPVSENEEDSYDEDVHDHRGGRGGTVSRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PARPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIHSLASDHS
GRSHDRAPRHSRSRSPDQRSEPSDHSRHSPQQPSNGSHRSREEERASKPGTVSPPVRHAD
DRAPKAVEEVPVERNEKAAATLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRC
SGKLVKFRKGDSVGLRLAGGNDVGFVAGVLEDPAAKEGLEEGDQILRVNNVDFTNIIREE
AVLFLLDLPRGEEVTILAQQKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEV
FRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRCLPWHRAEQLASVQYTLPKTAGG
DRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADV
AREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRL
NYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLN
SMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTD
SRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTFP
PYSPQAQPQPVHRLDSPGLKTASQQKADASSPGPYLSPETNPAPPTSAVNHSVKFTHVRL
EAPAPPASHSPPADSLPAPRAEAAHSLLRDHGAALPSHVDPAQVYRKDPYPEDIIRQNHV
VKQPAGGHPVLRPDRDPKPSYEPHAPYVEKQASRDLEQPTYRYDSSGYTDPFSRHMDHRL
RYEERIPAYEEHWSYYEDKQPYQPRPSDSQHPRDLDSRQHPEEPSERGYFPRFEEPAPLP
YDSRPRYEQPPRTSTLRHEEPLAPGYEVHGRYRPEAPPPAGPQAPESKQCYEQYPRSYEQ
VPAQGFTSKAGRYEPLHGAALVPPLVPASQHKPDVPPPSTKPLPAPPAPAEEEDPAMKPQ
SVLTRVKMFENKRSASLENRKDENHAGFKPPEAASKPPGAPIVGPKATLQSQFSEHDKTL
YRVPEPQKPQPKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPSAHIPTGHLPEP
AKPAHSQHPPSLSSYSSKGKSIDADAFGDKRYDSVQPTPPPPPLPSQYSQPPQPSSSSSL
HAHAKGAHGEGNSVSLDFQNSLVSKPEPPPSQNKPVTFRTMSREDPAPSTFYPQKSFPDK
APVNGTEQPQKTVAPAYNRFTPKPYTSSARPFERKFESPKFSHNLLPSETAHKPDVSSKV
PTSPKTLVKAQPPEFDSGVETFSIHTEKPRYHVNNLSTGPRAVPGSPSAVEEDNDEDGHT
VVATARGVFSSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGE
TLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGD
PNYLVGANCVSVLIDHF
Download sequence
Identical sequences G1P3E9
ENSMLUP00000004439 ENSMLUP00000004439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]