SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004458 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004458
Domain Number 1 Region: 213-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-55
Family Nuclear receptor ligand-binding domain 0.00000000544
Further Details:      
 
Domain Number 2 Region: 83-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004458   Gene: ENSMLUG00000004897   Transcript: ENSMLUT00000004893
Sequence length 407
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431502:21311:26881:-1 gene:ENSMLUG00000004897 transcript:ENSMLUT00000004893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTSTSQNTPLPGNVPPQPSAPSSKPVVKEERPEPWPGGPDPDVPGSDGVGSVCSVVI
PDPAEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGAGR
YACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQQQQSPS
APGVSSGSASGPGASPGGSDGGGQGPGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQ
PKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKA
STIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLD
DAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQ
Download sequence
Identical sequences G1P3G2
ENSMLUP00000004458 ENSMLUP00000004458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]