SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004531 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004531
Domain Number 1 Region: 228-302
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000109
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 304-360
Classification Level Classification E-value
Superfamily SH3-domain 0.0000294
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004531   Gene: ENSMLUG00000004969   Transcript: ENSMLUT00000004969
Sequence length 360
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:2397024:2402826:1 gene:ENSMLUG00000004969 transcript:ENSMLUT00000004969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKKVLETPKPSPAETRQSGLQRLKQLFRKESAGTKEMELPPEPQANGEAVGAGGGPIY
YIYEEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCK
NCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYASVSAANRNDPVFETLRTG
VIMANKERKKGQADKKNPLAAMMEEEPDSARPEGGKAQNGNPEGDKKAEKKTPDDKHKQP
GFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRV
RSGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI
Download sequence
Identical sequences G1P3M7
ENSMLUP00000004531 ENSMLUP00000004531 XP_014315407.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]