SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004542 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004542
Domain Number 1 Region: 133-183
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000033
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 265-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000465
Family GABARAP-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004542   Gene: ENSMLUG00000004985   Transcript: ENSMLUT00000004981
Sequence length 350
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429929:1493153:1507119:-1 gene:ENSMLUG00000004985 transcript:ENSMLUT00000004981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVPVLTRANAAAAKAEGAAAMPPPPPISPPALTPAPAAGEEDPPPLPEEGAPGCSGSR
PPELEPERSLGRLRGRFEDEDEELEEDEELEEEEEEEEEEMSHFSLRLEGCRPESEDEEE
RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ
PLYNIRLDRQLQDIVYKLVIDLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRTKKA
LESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMDLDP
ACQVDIICGDHLLERYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
Download sequence
Identical sequences G1P3N7
ENSMLUP00000004542 ENSMLUP00000004542 XP_006095984.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]