SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004551 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004551
Domain Number 1 Region: 6-89
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 627-691
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.08e-18
Family LIM domain 0.0086
Further Details:      
 
Domain Number 3 Region: 568-631
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1e-17
Family LIM domain 0.0067
Further Details:      
 
Domain Number 4 Region: 535-566
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000113
Family LIM domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004551   Gene: ENSMLUG00000004982   Transcript: ENSMLUT00000004990
Sequence length 691
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430065:631073:682588:1 gene:ENSMLUG00000004982 transcript:ENSMLUT00000004990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLAGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTAAPLIQSPLPVIPHQKDPALDTNPEVRAG
PGTEVRQTFSASFSQTSAFSSHLEASDPGPPQGSPGAKTSSEGALHSLSPKVPQGSSQPR
QYNNPIGLYSAETLREMAQLYQMSLRGKASGAGLPGGSLPVKDLAVDSASPVYQAVIKNQ
NKPEDEADEWARRSSNLQSRSFRILAQMTGTEYMQDPDEEALRRSSTPIEHAPVCTSQAT
TPLLPASAQPPIAASPSAASPPLAATAAHAAAASASAPASSPADSPRPQASAQGTAQATS
PAPAAHPYTEAPAAAAPKPRVVTTASIRPSVYQPVPANTYSPSPGANYSPTSYTPSPAPA
YTPSPAPTYTPSPAPANTPSPAPTYSLSPAPAYTPSPAPSYEPAPSVAHSRGPAESASRP
PWATDDSFSQKFAPGKSTTSISKQPLPGGTSAYTPGSQVPPLARGTFQRAERFPASSRTP
LCGHCNNVIRGPFLVAMGRSWHPEEFNCAYCKSSLADVCFVEEQGAVYCERCYEQFFAPI
CAKCNTKIMGEVMHALRQTWHTSCFICAACKKPFGNSLFHMEDGEPYCEKDYITLFSTKC
HGCDFPVEAGDKFIEALGHTWHDTCFICAVC
Download sequence
Identical sequences G1P3P5
ENSMLUP00000004551 ENSMLUP00000004551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]