SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004559 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004559
Domain Number 1 Region: 386-436,465-665
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.67e-37
Family PhyH-like 0.069
Further Details:      
 
Domain Number 2 Region: 60-181
Classification Level Classification E-value
Superfamily ARID-like 6.54e-32
Family ARID domain 0.00074
Further Details:      
 
Domain Number 3 Region: 312-379
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-17
Family PHD domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1183-1254
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000642
Family PHD domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004559   Gene: ENSMLUG00000004986   Transcript: ENSMLUT00000004999
Sequence length 1556
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429936:203044:233429:-1 gene:ENSMLUG00000004986 transcript:ENSMLUT00000004999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEESGGDMKVEPASPKTYLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDNKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQRLKNCLSEAEACVSRALGLVSGQEAGP
HRVADVQMTLAELRAFLDQMSNLPCAMHQIGDVKGVLDQVEAYQAEAREALASLPSSPAL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV
APSPAVDKARAELQELLTIAERWEEKAHICLEARQKHPPATLEAIIHEAENIPVHLPNIQ
ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSTKPSPLASSTTAASANSICVCGQVPAGAGAL
RCDLCQDWFHGRCVSVPRLLNSLRPSPPSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVSALLGRLTELRQRLQAEPR
PEEPPTLPSAPASDPLREGSGKDMPKAQGLENGDSVTSPEKVAPGEGSDLELLPSLLPQL
TGPVLELPEATRAPLEELMLEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLELEKAE
RHGSRGRGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEAQEEEELEEETGA
EGPPQPLPTTGSPSTQENQNGLEPAPGASSGPSAPFSTLTPRLPVPCPQQPPQQQS
Download sequence
Identical sequences G1P3Q3
ENSMLUP00000004559 ENSMLUP00000004559 XP_006096186.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]