SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004571 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004571
Domain Number 1 Region: 20-117
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-49
Family V set domains (antibody variable domain-like) 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004571   Gene: ENSMLUG00000024318   Transcript: ENSMLUT00000005013
Sequence length 118
Comment pep:novel scaffold:Myoluc2.0:GL430146:149693:150150:-1 gene:ENSMLUG00000024318 transcript:ENSMLUT00000005013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGLSWVFLVVILRGVQCDVQLVESGGDLVQPGGSLRLSCAASGFTFSSYWMHWVRQAP
GEGLEWVSLINPAGSSTYYANSVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCSRD
Download sequence
Identical sequences G1P3R4
ENSMLUP00000004571 ENSMLUP00000004571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]