SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004578 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004578
Domain Number 1 Region: 664-851
Classification Level Classification E-value
Superfamily Sec7 domain 1.2e-64
Family Sec7 domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 867-998
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004578   Gene: ENSMLUG00000005010   Transcript: ENSMLUT00000005021
Sequence length 1004
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429936:245289:327558:-1 gene:ENSMLUG00000005010 transcript:ENSMLUT00000005021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESQYQNLRETQFHHRELRESQFHQAARDVGYPNREGAYQNREAVYRDKERDASYPLQDT
TGYSARERDVAQCHLHHDNPALGRERGGREAGPAHPGRDKEGGYSAAAVGVGSRPPRERG
QLSRGASRSSSPGTGGGHSTSTSTSPATTLQRNVEGDAPGSDLSTAVDSPGSQPPYRLSQ
LPSSSSHMGGPPAGVGLPWAQRARLQPASVALRKQEEEEIKRSKALSDSYELSTDLQDKK
VEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNMRMRFS
FEEYEKAQNPAYFEGKPASLDEGAMAGARSHLLERGLPYAGSCGGGIDGGGSSVTTSGEF
SNDITELEDSFSKQQTQVKSLAESIDEALNCHPSGPMSEETGSAQLEKRESKEQQEDSSA
TSFSDLPLYLDDPIPPPSPERLPSAEPPPQSRPEFWAPAPLPPVPPPGPPGTREDGSREE
GPRRGPGCSECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADGCSPHG
TLKHKGPPGRAPILHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGARRLGKCEAAGEN
SDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATSLCKQTYQRETRHSWDSPAFNND
VVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNR
QKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPA
LVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLV
GIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPNRPQRL
GLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAV
PGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVECE
Download sequence
Identical sequences G1P3S0
ENSMLUP00000004578 ENSMLUP00000004578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]