SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004605 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004605
Domain Number 1 Region: 373-763
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.11e-127
Family Oxysterol-binding protein 0.0000378
Further Details:      
 
Domain Number 2 Region: 119-239
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-24
Family Pleckstrin-homology domain (PH domain) 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004605   Gene: ENSMLUG00000005046   Transcript: ENSMLUT00000005050
Sequence length 863
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429776:738640:786820:-1 gene:ENSMLUG00000005046 transcript:ENSMLUT00000005050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEGSSQQRRFSSCTVVSPVLCPPRIDGRKLVRNASFGGYNELSLPGFERGREDISQNRD
DSSLSMSKSKSESKLYNGSEKDSTASSKLTKKESLKVQKKNYREEKKRATKELLSSITDP
SVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKD
GFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKC
SSLLKRTMIREGKEHDLSISSESTHVTLYGLLRANNLHSGDNFQLNDSEIERQHFKDQDM
YSDKSDKENDQEHDESDNEVMGKSEDSDTDTSERQDDSYIEPEPIEPLKETTYTEQSHEE
LGEAGEASQTETVSEENKSLIWTLLKQVRPGMDLSRVVLPTFILEPRSFLDKLSDYYYHA
DFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGLKKPYNPILGETFRCLWIHPRTNSKTF
YIAEQVSHHPPISAFYVSNRKDGFCISGSILAKSKFYGNSLSAILDGEARLTFLNRGEDY
VMTMPYAHCKGILYGTMTLELGGTVNITCQKTGYSAILEFKLKPFLGNSDCVNQISGKLK
LGKEVLATLEGHWDSEVFINDKKTDNSEVFWNPTPDIKQWRLIRHTVKFEEQGDFESEKL
WQQVTRAINAKDQTEATQEKYVLEEAQRQSARDRKTKNEEWTCKLFELEPLTGEWHYKFA
DTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQD
SSGSEAQPVKPSTRRKKGIDLGDIQNSIESIKQAQEEIKRNITALRNHLVSSAPTTDYFL
QQKDYFIIFLLILLQVVINFMFK
Download sequence
Identical sequences G1P3U5
ENSMLUP00000004605 ENSMLUP00000004605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]