SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004620 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004620
Domain Number 1 Region: 63-344
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-54
Family Asparaginyl hydroxylase-like 0.079
Further Details:      
 
Domain Number 2 Region: 1029-1270
Classification Level Classification E-value
Superfamily RNI-like 4.71e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 3 Region: 628-695
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000271
Family PHD domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004620   Gene: ENSMLUG00000005065   Transcript: ENSMLUT00000005066
Sequence length 1282
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430182:718905:765475:-1 gene:ENSMLUG00000005065 transcript:ENSMLUT00000005066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRVKDGSRGVRAIHASRLNSFPPLQSRIDDEIEGKRTFDLEEKLHTNKYNANFVTFMEG
KDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGI
EMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKE
SQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAH
NLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNF
LHSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESL
SMVHSSRKESIFCDHMAKWLVLTAFFFIPTDLELNGLESGNGDEEAVDREPRRLSSRRSV
LTSPVANGVNLDYDGLGKTCRSLPSLKKSLSGDSSSDSSRGSHNGQVWDPQCSPRKDRQV
HLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKVLLEELANSDPKLALTGV
PIVQWPKRDKQNYQTRRPVSKFGCQVFVKAAASPIVSGARRRRVRCRKCKACVQGECGVC
HYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCIC
NEIVHPGCLQIMDGEGLLNEELPNCWECPKCYQEDSSEKAQVRGSPAPRGDQPHDLGHEQ
LWLLAQWSPVMSKGQKDSSYWGRQDKTCRWVARGCILVSPSDSRFLWEQCGLSQRFSFSA
LSRICPWSLGIGWGAEWKQQTGGGELRHWWSRRLCILVQMKRKMEESDEEAVQAKVLRPL
RSCDEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRL
QATERTMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITAS
SANLRHSPRVLVQHCPARTPQRGDEEGLGGEEEEEEDEEEEDDSAEDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS
Download sequence
Identical sequences G1P3W0
ENSMLUP00000004620 ENSMLUP00000004620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]