SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004637 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004637
Domain Number 1 Region: 335-457
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-22
Family Pleckstrin-homology domain (PH domain) 0.00000161
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004637
Domain Number - Region: 218-328
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000164
Family Synaptotagmin-like (S variant) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004637   Gene: ENSMLUG00000005076   Transcript: ENSMLUT00000005083
Sequence length 1154
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429840:4261077:4570996:1 gene:ENSMLUG00000005076 transcript:ENSMLUT00000005083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFQVFLKSDRVARMVQSGGCSANDFREVFKKNIEKRVRSLPEIDGLSKETVLSSWIAKYD
AIYRGEEDLCKQPSRMTLSAVSELILSKEQLYEMFQQILGIKKLEHQLLYNACQLDNADE
QAAQIRRELDGRLQLAEKMAKERKFPKFITKEMETMYIEELRSSVNLLMANLESLPVSKG
GPEFKLQKLKRSQNSAFLDIGDESEIQLSKSDVVLSFTLEIVIMEVQGLKSVAPNRIVYC
TMEVEGGEKLQTDQAEASRPQWGTQGDFTTTHPRPVVKVKLFTESTGVLALEDKELGRVI
LYPTSNSSKSAELHQMIVPKNSQDSDLKIKLAVRMDKPPHMKHSGYLYALGQKVWKRWKK
RYFVLVQVSQYTFAMCSYREKKSEPQELMQLEGYTVDYTDPHPGLQGGRMFFNAVKEGDT
VIFASDDEQDRILWVQAMYRATGQSYKPIPAIQTQKLNPKGGTLQADAQLYADRFQKHGM
DEFISANPCKLDHASLFRILQRQTLDHRLNDSYSCLGWFSPGQVFVLDEYCARYGVRGCH
RHLCYLAELMEHSENGAVIDPTLLHYSFAFCASHVHGNRAEVYGTVAMEEHEFFEDELQV
RLTSVAIKCITHRRYCFPFGRPEGALKATLSLLERVLMKDIATPIPAEEVKKVVRKCLEK
AALINYTRLTEYAKIEGPAEKETETMSQAAPARKLEEVLHLAELCIEVLQQNEEHHAEGR
EAFAWWPDLLAEHAEKFWALFTVDMDTALEAQPQDSWDSFPLFQLLNNFLRNDTLLCNGT
FHKHLQEIFVPLVVRYVDLMESSIAQSIHRGFEQETWQPVKNIANSLPNVALPKVPSLPL
NLPQIPSFSTPSWMAPLNESTNGSATSEDLFWKLDALQMFVLDLHWPEQEFAHHLEQRLK
LMASDMIEACVKRTRAAFELKLQKANKTTDLRIPASVCTMFNVLVDAKKQSTKLCALDGG
QEQQYHSKIDDLIDNTVKEFLSLLVSKFISVLEGVLSKLSRYDEGTFFSSILSFTVKAAA
KYVDVPKPGMDLADTYIMFVRQNQDILREKVNEEMYIEKLFDQWYSSSMKVICVWLADRL
DLQLHIYQLKTLIKIVKKTYRDFRLQGVLEGTLNSKTYDTVHRRLTVEEATASVSEGGGL
QGITMKDSDEEEEA
Download sequence
Identical sequences G1P3X7
ENSMLUP00000004637 ENSMLUP00000004637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]