SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004682 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004682
Domain Number 1 Region: 287-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-51
Family SPRY domain 0.000082
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004682   Gene: ENSMLUG00000005136   Transcript: ENSMLUT00000005132
Sequence length 487
Comment pep:novel scaffold:Myoluc2.0:GL429812:5947380:5954887:1 gene:ENSMLUG00000005136 transcript:ENSMLUT00000005132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLVSMTELEDRLQCPICLEIFKEPLMLQCGHSYCKGCLLSLFCHLDSELRCPVCRQEV
DGSRSPPNLSLARVIEALGLPRDPEPKVCAHHRNPLSLFCEKDQELICGLCGLLGSHQHH
RVTPVSTVYSRMKEELATLISDLKQEQKKVDEHIGKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGVEGHTRGLLASLDMQLEQAHSTRERLVQAKCVLEQFGNENHHEF
IRKYHSMASRAELQPARPLESTFNPISFKPGLHQADIKLTVWKRLFRKVLPAPESLKLDP
TTAHPLLELSKGNTVVQCGLLAQRCASQPERFDYSTCVLASRGFSCGRHYWEVVVGIKSD
WRLGVIKGTASRKGKLSKSPEHGMWLIGLKEGRVYEAFGCPRVPLPVAGHPHRIGVYLHY
EQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPSHLS
SPQPTKL
Download sequence
Identical sequences G1P417
ENSMLUP00000004682 ENSMLUP00000004682 XP_006088310.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]