SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004765 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004765
Domain Number 1 Region: 129-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.26e-34
Family UAS domain 0.03
Further Details:      
 
Domain Number 2 Region: 348-444
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-20
Family UBX domain 0.0055
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.0000578
Family TAP-C domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004765   Gene: ENSMLUG00000005219   Transcript: ENSMLUT00000005223
Sequence length 445
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:1481241:1515929:1 gene:ENSMLUG00000005219 transcript:ENSMLUT00000005223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEEQDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRF
IRPDPRSRVTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGD
DHQDSDEFCRNTLCAPEVISLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKD
RRMTVVGRLEGLIQPDDLINQLTFIIDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS
LRADQEKERKKREERERKRRKEEEVKQQKLAEERRRQNLQEEKERKLERLPPEPSPDDPE
SVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW
PNPPTLQEAGLSHTEVLFVQDLTDE
Download sequence
Identical sequences G1P493
ENSMLUP00000004765 ENSMLUP00000004765 XP_006081652.1.53796 XP_006763767.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]