SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004775 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004775
Domain Number 1 Region: 10-66,94-147
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-28
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004775   Gene: ENSMLUG00000005236   Transcript: ENSMLUT00000005234
Sequence length 442
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:128975:157496:1 gene:ENSMLUG00000005236 transcript:ENSMLUT00000005234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLKPKYPFNDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPENGRSGFLIHG
ERQKDKLSILASLTLPMPHSETVLSVVFPIFCKKVVLECYVRKDLVYTKANPTFHHWKVD
NRKFGLTFQSPADARAFDRGVRKAIEDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSN
SSQKREQPTRTISSPTSCEHRRIYTLGHLHDPYPADHYHLEQPMPRPYRQVSFPDDDEEI
VRINPREKIWVTGYEDYRHAPVRKALDPAEDADSYVRFAKGEVPKHDYNYPYVDSSDFGL
GEDPKGRGGGVIKTQPSRGKPRRRKEDGERSRCEYCRDMFNHEENRRGHCQDAPDSVRTC
IRRVSCMWCADSLLYHCMSDPEGDYTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLP
LRACYHCGVMCRCCGGRHKAAV
Download sequence
Identical sequences G1P4A2
ENSMLUP00000004775 ENSMLUP00000004775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]