SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004902 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004902
Domain Number 1 Region: 820-1180
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.67e-76
Family Ankyrin repeat 0.0000193
Further Details:      
 
Domain Number 2 Region: 1199-1332
Classification Level Classification E-value
Superfamily TPR-like 6.78e-23
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 
Domain Number 3 Region: 269-352,468-528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000037
Family Nitrogenase iron protein-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004902   Gene: ENSMLUG00000005358   Transcript: ENSMLUT00000005372
Sequence length 1765
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:19954460:20042848:-1 gene:ENSMLUG00000005358 transcript:ENSMLUT00000005372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPVRKPKYVESPRVPGDAVIIPFRDVSQPTEPNENEAKADNEPSCSPAAQELLTRLGFLL
GEGIPSSTHITIEEKNETMCTALSQGISPCSTLTSSTASPSTDSPCSTLNSCVSKTAANK
SPCETISSPSSTLESKDSGIIATITSSSENDDRSGSSLEWNKDGSLRLGVQKGVLHDRRA
DNCSPVAEEEPAGSAESVLPTAEGPGGDGPVPYSQSSSSLIMPRPNSVAATSSTKLEDLS
YLDGQRNAPLRTSIRLPWHSTAGARFAPYKPQDILLKPLLFEVPSITTDSVFVGREWLFQ
QIEQNLRNTELPENRGAVVVGNVGFGKTAIISKLVALSCHGSRMRQIASNSPGSSPKTSD
SSPDLPFTPLLSPSTSPGGTTTARTPAGLGSDAPENQRPREDAAKYLASKVVAYHYCQAD
NTYTCLVPEFVHSIAALLCRSHQLAAYRDLLIREPQLQSMLSLRSCVQDPVAAFKRGVLE
PLTSLRNEQKIPEEEYIILIDGLNEAEFHKPDYGDTLSSFIAKIISKFPAWLKLIVTVRA
NFQEIVSGLPFVKLSLDDFPDNKDIHSDLHAYVQHRVHSSQDILSNISLNGKADAALIGK
VSSHLVLRSLGSYLYLKLTLDLFQRGHLVIKSASYKVVPVSLSELYLLQCNMKFMTQSAF
ERALPILNVALASLHPMTDEQIFQAINAGHIQGQGREDFQQRMEALSCFLIKRRDKTRMF
CHPSFREWLVWRADGENTAFLCEPRNGHALLAFMFSRQEGKLNRQQTMELGHHILKAHIF
KGLSKKTGISSSHLQALWIGYSTEGLSAALASLRNLYTPNVKVSRLLILGGANVNYRTEV
LNNAPILCVQSHLGHEEVVTLLLEFGACLDGMSENGMTALCYAAAAGHMKLVCLLVKKGA
RLDHLDKKGQCALVHSALRGHSDVLQYLLACEWSAGAPQPGALKKSHALQQALTAAASMG
HGSVVECLLGLEKEHEIDVNGTDTLWGETALTAAAGRGKLEVCELLLERGAAVSQANRRG
VPPLFCAARQGHWQIVRLLLERGCDVNLSDKQGRTPLMVAACEGHLSTVEFLLSKGAALS
SLDKEGLSALSWACLKGHRAVVQFLVEEGAEIDQMDKNGRTPLDLAAFYGDAETVLYLVD
KGAVIEHVDHSGMRPLDRAIGCRNTSVVVTLLRKGAKLGNAAWAMATSKPDILIILLQKL
MEEGNMLYKKGKMKEAAQRYQYALRKFPREGFGEDMRPFNELRVSLYLNLSRCRRKTNDF
GMAEEFASKALELKPKSYEAFYARARAKRNSRQFAAALADLREAVKLCPTNQEIRRLLAR
VEEECKQLQRSQQQKQQGPPPAPPTDSDNEEEAPAPAPGDHLHLEEAAEDTSPQEGSVSL
TPRPHPSAPSPYIRNLQEGLQAKMRPASPQNRPGAAQPPREPVAQPGLVVQPTKQAQIVK
TSQHLGCGQAGVRSGSMRLQGSSAHPPPSPMPGRISVATAGGRGPHSEGAGTFTAGAGPG
RFGERPGPGHGVPLQPSEGGAAYPLPSKIRSAERLLSHAAVAVDVAPLSQGGPVGGSDMR
HPASLASSGSSGSPSSSIKMSSSTSSLTSSSSFSDGFKGPGPEARVKDKAVHQVPSGTAE
HRPRNTPFMGIMDKTARFQQQSNPPGRTWHAAVSEGLLTHTPAAGPQASNPEKPSLKQAA
GYHSQAKACAAATLGGSIHNGAPVKELEDRKCPVPAHCQDTRISKTVAHLYQESISKQQP
HLGNEAHRSHLPAAKPKRSFIESNV
Download sequence
Identical sequences G1P4L3
ENSMLUP00000004902 ENSMLUP00000004902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]