SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004960 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004960
Domain Number 1 Region: 99-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 243-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-23
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 482-545
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 4 Region: 564-596,630-718
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000366
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004960   Gene: ENSMLUG00000005428   Transcript: ENSMLUT00000005438
Sequence length 751
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430006:1346868:1359047:-1 gene:ENSMLUG00000005428 transcript:ENSMLUT00000005438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISGSYIPSASGPFSALTPSIWPQEILAKHTQKEESVEQPEFYYDEFGFRVDKEEGADPSS
SRLPAVSLMEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAASLPRSEKLRSLVLAGIPHSM
RPQLWMRLSGALQKKRNSELSYREMVKNSSNDETIAAKQIEKDLLRTMPSNACFANESSI
GVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDTFWMMCAIIEDLLPASYFST
TLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRLWD
LFFYEGSLVLFQATLGMLRLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGEAMRLAG
SLTDVAVETQRRKHLAYLLADQGQLLGTSTTTNLSQVVRRRTQRRKSGFTSLLFGEDDLE
ALKAKNIKQTELVADLREAILRVARHFQCTDPKNCNVELTPDYSMESHQRDHENYVACSR
SHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDE
RSKEYSIAGDDTVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGRE
VERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLIC
VGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWEL
PMKREEEKKPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences G1P4R6
ENSMLUP00000004960 ENSMLUP00000004960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]