SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004968 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004968
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-39
Family Phosphotyrosine-binding domain (PTB) 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004968   Gene: ENSMLUG00000005444   Transcript: ENSMLUT00000005447
Sequence length 768
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429835:3822293:3839503:-1 gene:ENSMLUG00000005444 transcript:ENSMLUT00000005447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNEVETSTSNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGAEGQHQFFAIKTGQQAEPLVIDLKDLFQVIYNVKKKEEEKK
KMEEANNAVENGSEALMTLDDQANKLKLAVDRMDLFGDMSTPPDLNSPTESKDILLVDLN
SEINTNQNSLRENSLTNGITSSSLPRPKPQASFLPENAFPANLHFFPTPNPDPFRDDPFA
QQDQSPPSSFDSLKSPDQKTENLSGLSTRLSNGPLNGDVDYFGQQFDQISNRTGKQEAQA
DPWPLSSPQTQPAVRTQNGVSDREQNGFHVKSSPNPFVGSPPKGLPVPNGLKQDLESSVQ
SSTHDSIAIIPPPQSTKPGRGRRTAKSPANDLLTSDIFAPPDSEPPGQASPTGQSATPQT
NPLDLFKTSVSPPVGPLAGLGGVAITPPHTGPWSPPSLVFNQSPSMVPGAMMGAQPAGFS
QPMVFTTSPAVAGWNQPSSFAASTPPPAPVVWGPSASVSPNTWSSASPLGNPFQSNIFPV
PAVSTQSPPMLSSLLVTPPQPPPRTGPPKDISTNAFVALDPLGDQEVKEVKEMFKDLQLR
QPPVPARKGDQPSSGTSSAFSSYFNSKVGIPQENADHDDFDANQLLKKINEPPKPAPRQG
APPVTNSSDNAFENPFSKNAFSSSQASMTSPQPASPDVYRDPFGSPFA
Download sequence
Identical sequences G1P4S4
XP_006090200.1.53796 XP_014312546.1.53796 XP_014312547.1.53796 ENSMLUP00000004968 ENSMLUP00000004968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]