SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004993 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004993
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-34
Family Pleckstrin-homology domain (PH domain) 0.00000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004993   Gene: ENSMLUG00000005474   Transcript: ENSMLUT00000005473
Sequence length 231
Comment pep:known_by_projection scaffold:Myoluc2.0:AAPE02063723:5573:14491:-1 gene:ENSMLUG00000005474 transcript:ENSMLUT00000005473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEEANDCGESADRNHLKRSPSHLPCFPPKPPSDSAVIKAGYCVKQGAVMKNWKRRYFQLD
ENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTSSRTFYVQADSPEE
MHSWIKAVSGAIVAQRGPGRSASSMRQARRLSNPCIQRYTPRTGGCGTSSPAAPSPSPRP
APPPRIPPPLAAALWSQALPWRSEDFANLLPRSSQGASRSRLSLQEHQLPK
Download sequence
Identical sequences G1P4U6
ENSMLUP00000004993 ENSMLUP00000004993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]